SCOPe 2.08: Domain d6wm2f3: 6wm2 F:402-506

Lineage for d6wm2f3 (6wm2 F:402-506)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [396080] (2 PDB entries)

8. Domain d6wm2f3: 6wm2 F:402-506 [396130]
   Other proteins in same PDB: d6wm2d1, d6wm2d2, d6wm2e1, d6wm2e2, d6wm2f1, d6wm2f2, d6wm2g_, d6wm2n_, d6wm2q_
   automated match to d3gqbb3
   complexed with adp, clr, nag, psf, pty, wjp, wjs, wss

Details for d6wm2f3

PDB Entry: 6wm2, 3.1 Å

PDB Description: human v-atpase in state 1 with sidk and adp

PDB Compounds: (F:) V-type proton ATPase subunit B, brain isoform

SCOPe Domain Sequences for d6wm2f3:

Sequence; same for both SEQRES and ATOM records:

>d6wm2f3 a.69.1.0 (F:402-506) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksaigegmtrkdhadvsnqlyacyaigkdvqamkavvgeealtsddllyleflqkfern
fiaqgpyenrtvfetldigwqllrifpkemlkripqstlsefypr

Timeline for d6wm2f3:

• d6wm2f3 first appeared in SCOPe 2.07