Lineage for d6l9la_ (6l9l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)
  8. 2938591Domain d6l9la_: 6l9l A: [395101]
    Other proteins in same PDB: d6l9lc1, d6l9lc2, d6l9ld1, d6l9ld2, d6l9lg1, d6l9lg2, d6l9lh1, d6l9lh2
    automated match to d1tmca_

Details for d6l9la_

PDB Entry: 6l9l (more details), 2.4 Å

PDB Description: 1d4 tcr recognition of h2-ld a1a2 a5 peptide complexes
PDB Compounds: (A:) H2-Ld a1a2

SCOPe Domain Sequences for d6l9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9la_ d.19.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gphsmryyetatsrrglgeprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqrmygcdvgsdgrllrgyeqfaydg
cdyialnedlrtwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkng

SCOPe Domain Coordinates for d6l9la_:

Click to download the PDB-style file with coordinates for d6l9la_.
(The format of our PDB-style files is described here.)

Timeline for d6l9la_: