SCOPe 2.08: Domain d6l9ld2: 6l9l D:111-239

Lineage for d6l9ld2 (6l9l D:111-239)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6l9ld2: 6l9l D:111-239 [395236]
   Other proteins in same PDB: d6l9la_, d6l9lc1, d6l9ld1, d6l9le_, d6l9lg1, d6l9lh1
   automated match to d2esve2

Details for d6l9ld2

PDB Entry: 6l9l, 2.4 Å

PDB Description: 1d4 tcr recognition of h2-ld a1a2 a5 peptide complexes

PDB Compounds: (D:) t cell receptor

SCOPe Domain Sequences for d6l9ld2:

Sequence; same for both SEQRES and ATOM records:

>d6l9ld2 b.1.1.2 (D:111-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6l9ld2:

• d6l9ld2 first appeared in SCOPe 2.07