Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6l9ld2: 6l9l D:111-239 [395236] Other proteins in same PDB: d6l9la_, d6l9lc1, d6l9ld1, d6l9le_, d6l9lg1, d6l9lh1 automated match to d2esve2 |
PDB Entry: 6l9l (more details), 2.4 Å
SCOPe Domain Sequences for d6l9ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9ld2 b.1.1.2 (D:111-239) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d6l9ld2: