Lineage for d1e6ya2 (1e6y A:1002-1283)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) 
each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structuresFamily d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
C-terminal domain is all-alpha
Protein Alpha chain [55095] (3 species) 
Species Methanosarcina barkeri [TaxId:2208] [55098] (1 PDB entry) 
Domain d1e6ya2: 1e6y A:1002-1283 [39447]
Other proteins in same PDB: d1e6ya1, d1e6yb1, d1e6yb2, d1e6yc_, d1e6yd1, d1e6ye1, d1e6ye2, d1e6yf_
complexed with com, f43, gol, tp7
Details for d1e6ya2
PDB Entry: 1e6y (more details), 1.6 Å
PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri
PDB Compounds: (A:) methyl-coenzyme m reductase subunit alphaSCOPe Domain Sequences for d1e6ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ya2 d.58.31.2 (A:1002-1283) Alpha chain {Methanosarcina barkeri [TaxId: 2208]}
aadifskfkkdmevkfaqefgsnkqtggditdktakflrlgpeqdprkvemikagkeiae
krgiafynpmmhsgaplgqraitpytisgtdivcepddlhyvnnaamqqmwddirrtciv
gldmahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpalvddcyvkvft
gddaladeidkqflidinkefseeqaaqikasigktswqaihiptivsrttdgaqtsrwa
amqigmsfisayamcageaavadlsfaakhaalvsmgemlpa
SCOPe Domain Coordinates for d1e6ya2:
Click to download the PDB-style file with coordinates for d1e6ya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e6ya2:
View in 3D
