![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
![]() | Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
![]() | Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
![]() | Species Methanosarcina barkeri [TaxId:2208] [55093] (1 PDB entry) |
![]() | Domain d1e6yc_: 1e6y C: [39441] Other proteins in same PDB: d1e6ya1, d1e6ya2, d1e6yb1, d1e6yb2, d1e6yd1, d1e6yd2, d1e6ye1, d1e6ye2 complexed with com, f43, gol, tp7 |
PDB Entry: 1e6y (more details), 1.6 Å
SCOPe Domain Sequences for d1e6yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6yc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanosarcina barkeri [TaxId: 2208]} ayerqyypgatsvaanrrkhmsgkleklreisdedltavlghrapgsdypsthpplaemg epacstrenvaatpgaaagdrvryiqfadsmynapatpyfrsyfaainfrgvdpgtlsgr qivearerdmeqcakvqmeteitdhalagvrgatvhghsvrlqedgvmfdmldrrrleng tiimdkdqvaipldrkvdlgkpmsseeaakrttiyrvdnvafrddaevvewvhrifdqrt kfgfqpk
Timeline for d1e6yc_: