Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
Protein Alpha chain [55095] (3 species) |
Species Methanosarcina barkeri [TaxId:2208] [55098] (1 PDB entry) |
Domain d1e6ya2: 1e6y A:1002-1283 [39447] Other proteins in same PDB: d1e6ya1, d1e6yb1, d1e6yb2, d1e6yc_, d1e6yd1, d1e6ye1, d1e6ye2, d1e6yf_ complexed with com, f43, gol, tp7 |
PDB Entry: 1e6y (more details), 1.6 Å
SCOPe Domain Sequences for d1e6ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ya2 d.58.31.2 (A:1002-1283) Alpha chain {Methanosarcina barkeri [TaxId: 2208]} aadifskfkkdmevkfaqefgsnkqtggditdktakflrlgpeqdprkvemikagkeiae krgiafynpmmhsgaplgqraitpytisgtdivcepddlhyvnnaamqqmwddirrtciv gldmahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpalvddcyvkvft gddaladeidkqflidinkefseeqaaqikasigktswqaihiptivsrttdgaqtsrwa amqigmsfisayamcageaavadlsfaakhaalvsmgemlpa
Timeline for d1e6ya2: