Lineage for d1mrod2 (1mro D:2-269)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955084Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2955085Protein Alpha chain [55095] (3 species)
  7. 2955086Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 2955090Domain d1mrod2: 1mro D:2-269 [39444]
    Other proteins in same PDB: d1mroa1, d1mrob1, d1mrob2, d1mroc_, d1mrod1, d1mroe1, d1mroe2, d1mrof_
    complexed with com, f43, gol, na, tp7, zn

Details for d1mrod2

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (D:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mrod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrod2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1mrod2:

Click to download the PDB-style file with coordinates for d1mrod2.
(The format of our PDB-style files is described here.)

Timeline for d1mrod2: