SCOPe 2.08: Domain d1mrod2: 1mro D:2-269

Lineage for d1mrod2 (1mro D:2-269)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [55095] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)

8. Domain d1mrod2: 1mro D:2-269 [39444]
   Other proteins in same PDB: d1mroa1, d1mrob1, d1mrob2, d1mroc_, d1mrod1, d1mroe1, d1mroe2, d1mrof_
   complexed with com, f43, gol, na, tp7, zn

Details for d1mrod2

PDB Entry: 1mro, 1.16 Å

PDB Description: methyl-coenzyme m reductase

PDB Compounds: (D:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mrod2:

Sequence; same for both SEQRES and ATOM records:

>d1mrod2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

Timeline for d1mrod2:

• d1mrod2 first appeared (with stable ids) in SCOP 1.55
  
• d1mrod2 appears in SCOPe 2.07