SCOPe 2.08: Domain d1mroa1: 1mro A:270-549

Lineage for d1mroa1 (1mro A:270-549)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [48083] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)

8. Domain d1mroa1: 1mro A:270-549 [18525]
   Other proteins in same PDB: d1mroa2, d1mrob1, d1mrob2, d1mroc_, d1mrod2, d1mroe1, d1mroe2, d1mrof_
   complexed with com, f43, gol, na, tp7, zn

Details for d1mroa1

PDB Entry: 1mro, 1.16 Å

PDB Description: methyl-coenzyme m reductase

PDB Compounds: (A:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mroa1:

Sequence; same for both SEQRES and ATOM records:

>d1mroa1 a.89.1.1 (A:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

Timeline for d1mroa1:

• d1mroa1 first appeared (with stable ids) in SCOP 1.55
  
• d1mroa1 appears in SCOPe 2.07