Lineage for d1mrob1 (1mro B:189-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719688Protein Beta chain [48087] (3 species)
  7. 2719689Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 2719692Domain d1mrob1: 1mro B:189-443 [18531]
    Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob2, d1mroc_, d1mrod1, d1mrod2, d1mroe2, d1mrof_
    complexed with com, f43, gol, na, tp7, zn

Details for d1mrob1

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (B:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mrob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrob1 a.89.1.1 (B:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d1mrob1:

Click to download the PDB-style file with coordinates for d1mrob1.
(The format of our PDB-style files is described here.)

Timeline for d1mrob1: