Lineage for d1mrof_ (1mro F:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258057Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 258058Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 258059Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 258060Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 258064Domain d1mrof_: 1mro F: [39438]
    Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mrob2, d1mrod1, d1mrod2, d1mroe1, d1mroe2
    complexed with com, f43, gol, mgn, na, tp7, zn

Details for d1mrof_

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1mrof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrof_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1mrof_:

Click to download the PDB-style file with coordinates for d1mrof_.
(The format of our PDB-style files is described here.)

Timeline for d1mrof_: