Lineage for d1mroa1 (1mro A:270-549)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215786Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 215787Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 215788Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 215789Protein Alpha chain [48083] (3 species)
  7. 215790Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (5 PDB entries)
  8. 215793Domain d1mroa1: 1mro A:270-549 [18525]
    Other proteins in same PDB: d1mroa2, d1mrob1, d1mrob2, d1mroc_, d1mrod2, d1mroe1, d1mroe2, d1mrof_

Details for d1mroa1

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1mroa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mroa1 a.89.1.1 (A:270-549) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOP Domain Coordinates for d1mroa1:

Click to download the PDB-style file with coordinates for d1mroa1.
(The format of our PDB-style files is described here.)

Timeline for d1mroa1: