SCOPe 2.08: Domain d6z3pl_: 6z3p L:

Lineage for d6z3pl_ (6z3p L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6z3pl_: 6z3p L: [393823]
   Other proteins in same PDB: d6z3pa_, d6z3pb_, d6z3pc_, d6z3ph_
   automated match to d1igml_
   complexed with sph

Details for d6z3pl_

PDB Entry: 6z3p, 2.8 Å

PDB Description: structure of ev71 in complex with a protective antibody 38-3-11a fab

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6z3pl_:

Sequence; same for both SEQRES and ATOM records:

>d6z3pl_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystprtfgpgtkvdikr

Timeline for d6z3pl_:

• d6z3pl_ first appeared in SCOPe 2.07