![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (51 species) not a true protein |
![]() | Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries) |
![]() | Domain d6z3pb_: 6z3p B: [393821] Other proteins in same PDB: d6z3pc_, d6z3ph_, d6z3pl_ automated match to d3zfeb_ complexed with sph |
PDB Entry: 6z3p (more details), 2.8 Å
SCOPe Domain Sequences for d6z3pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z3pb_ b.121.4.0 (B:) automated matches {Enterovirus a71 [TaxId: 39054]} sdrvaqltignstittqeaaniivgygewpsycsdddatavdkptrpdvsvnrfytldtk lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvailpe yvigtvaggtgtedshppyiqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn catiivpymntlpfdsalnhcnfgllvvpispldfdqgatpvipititlapmcsefaglr qavtq
Timeline for d6z3pb_:
![]() Domains from other chains: (mouse over for more information) d6z3pa_, d6z3pc_, d6z3ph_, d6z3pl_ |