SCOPe 2.08: Domain d6yjwb1: 6yjw B:14-119

Lineage for d6yjwb1 (6yjw B:14-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Fragaria ananassa [TaxId:3747] [377209] (5 PDB entries)

8. Domain d6yjwb1: 6yjw B:14-119 [393730]
   Other proteins in same PDB: d6yjwa2, d6yjwa3, d6yjwb2, d6yjwb3
   automated match to d1kyze1
   complexed with edo, epe, sah

Details for d6yjwb1

PDB Entry: 6yjw, 2.1 Å

PDB Description: structure of fragaria ananassa o-methyltransferase crystallized with pas polypeptide

PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d6yjwb1:

Sequence; same for both SEQRES and ATOM records:

>d6yjwb1 a.4.5.0 (B:14-119) automated matches {Fragaria ananassa [TaxId: 3747]}
vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea
pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltkne

Timeline for d6yjwb1:

• d6yjwb1 first appeared in SCOPe 2.07