SCOPe 2.08: Domain d6yema1: 6yem A:1-196

Lineage for d6yema1 (6yem A:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (8 species)

7. Species Influenza A virus (a/california/07/2009(h1n1)) [TaxId:641809] [393669] (4 PDB entries)

8. Domain d6yema1: 6yem A:1-196 [393687]
   Other proteins in same PDB: d6yema2
   automated match to d4e5ed_
   complexed with cl, mg, mn, ooh

Details for d6yema1

PDB Entry: 6yem, 2.5 Å

PDB Description: h1n1 2009 pa endonuclease in complex with quambalarine b

PDB Compounds: (A:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d6yema1:

Sequence; same for both SEQRES and ATOM records:

>d6yema1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus (a/california/07/2009(h1n1)) [TaxId: 641809]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser

Timeline for d6yema1:

• d6yema1 first appeared in SCOPe 2.07