Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.0: automated matches [227186] (1 protein) not a true family |
Protein automated matches [226908] (5 species) not a true protein |
Species Cryptococcus neoformans [TaxId:235443] [393420] (1 PDB entry) |
Domain d6xr5c2: 6xr5 C:192-395 [393469] Other proteins in same PDB: d6xr5a1, d6xr5a3, d6xr5b1, d6xr5b3, d6xr5c1, d6xr5c3, d6xr5d1, d6xr5d3, d6xr5e1, d6xr5f1, d6xr5g1, d6xr5h1, d6xr5h3 automated match to d3f0na2 complexed with ade, edo, so4 |
PDB Entry: 6xr5 (more details), 1.7 Å
SCOPe Domain Sequences for d6xr5c2:
Sequence, based on SEQRES records: (download)
>d6xr5c2 d.58.26.0 (C:192-395) automated matches {Cryptococcus neoformans [TaxId: 235443]} emhalicvvsdakkgtsstsgmqktvetstllqerlrvvpkrmdaisqaikardfaefak ltmadsnsfhavcldtappifylndvsraiiavveelnraageiiaaytfdagpnaviyt leknmpfvlgaikrffptseefespfqtgvrdlpegfntgvvreggwekgavkglihtrv gdgprvlekedsllgengvpkvla
>d6xr5c2 d.58.26.0 (C:192-395) automated matches {Cryptococcus neoformans [TaxId: 235443]} emhalicvvsdasstsgmqktvetstllqerlrvvpkrmdaisqaikardfaefakltma dsnsfhavcldtappifylndvsraiiavveelnraageiiaaytfdagpnaviytlekn mpfvlgaikrffptseefgvrdlpegfntgvvreggwekgavkglihtrvgdgprvleke dsllgengvpkvla
Timeline for d6xr5c2: