Lineage for d3f0na2 (3f0n A:194-397)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561426Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561567Family d.58.26.0: automated matches [227186] (1 protein)
    not a true family
  6. 2561568Protein automated matches [226908] (5 species)
    not a true protein
  7. 2561583Species Mouse (Mus musculus) [TaxId:10090] [225563] (1 PDB entry)
  8. 2561584Domain d3f0na2: 3f0n A:194-397 [209756]
    Other proteins in same PDB: d3f0na1, d3f0na3, d3f0nb1
    automated match to d1fi4a2
    complexed with po4

Details for d3f0na2

PDB Entry: 3f0n (more details), 1.9 Å

PDB Description: mus musculus mevalonate pyrophosphate decarboxylase
PDB Compounds: (A:) mevalonate pyrophosphate decarboxylase

SCOPe Domain Sequences for d3f0na2:

Sequence, based on SEQRES records: (download)

>d3f0na2 d.58.26.0 (A:194-397) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlrililvvsadkkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqdfqgfa
qltmkdsnqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagpnavif
tledtvaefvaavrhsfppaangdkflkglqvapvllsdelkaalvvepspggvqyiiat
qvgpgpqvlddthdhllgqdglpq

Sequence, based on observed residues (ATOM records): (download)

>d3f0na2 d.58.26.0 (A:194-397) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlrililvvsadkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqdfqgfaq
ltmkdsnqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagpnavift
ledtvaefvaavrhsfppaankflkglqvapvllsdelkaalvvepspggvqyiiatqvg
pgpqvlddthdhllgqdglpq

SCOPe Domain Coordinates for d3f0na2:

Click to download the PDB-style file with coordinates for d3f0na2.
(The format of our PDB-style files is described here.)

Timeline for d3f0na2: