SCOPe 2.07: Domain d6xr5d2: 6xr5 D:192-395

Lineage for d6xr5d2 (6xr5 D:192-395)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.0: automated matches [227186] (1 protein)
   not a true family

6. Protein automated matches [226908] (5 species)
   not a true protein

7. Species Cryptococcus neoformans [TaxId:235443] [393420] (1 PDB entry)

8. Domain d6xr5d2: 6xr5 D:192-395 [393456]
   Other proteins in same PDB: d6xr5a1, d6xr5a3, d6xr5b1, d6xr5b3, d6xr5c1, d6xr5c3, d6xr5d1, d6xr5d3, d6xr5e1, d6xr5f1, d6xr5g1, d6xr5h1, d6xr5h3
   automated match to d3f0na2
   complexed with ade, edo, so4

Details for d6xr5d2

PDB Entry: 6xr5, 1.7 Å

PDB Description: crystal structure of diphosphomevalonate decarboxylase (mvd1) cryptococcus neoformans var. grubii serotype a

PDB Compounds: (D:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d6xr5d2:

Sequence, based on SEQRES records:

>d6xr5d2 d.58.26.0 (D:192-395) automated matches {Cryptococcus neoformans [TaxId: 235443]}
emhalicvvsdakkgtsstsgmqktvetstllqerlrvvpkrmdaisqaikardfaefak
ltmadsnsfhavcldtappifylndvsraiiavveelnraageiiaaytfdagpnaviyt
leknmpfvlgaikrffptseefespfqtgvrdlpegfntgvvreggwekgavkglihtrv
gdgprvlekedsllgengvpkvla

Sequence, based on observed residues (ATOM records):

>d6xr5d2 d.58.26.0 (D:192-395) automated matches {Cryptococcus neoformans [TaxId: 235443]}
emhalicvvsdaksstsgmqktvetstllqerlrvvpkrmdaisqaikardfaefakltm
adsnsfhavcldtappifylndvsraiiavveelnraageiiaaytfdagpnaviytlek
nmpfvlgaikrffptseefespfqtgvrdlpegfntgvvreggwekgavkglihtrvgdg
prvlekedsllgengvpkvla

Timeline for d6xr5d2:

• d6xr5d2 is new in SCOPe 2.07-stable
  
• d6xr5d2 appears in the current release, SCOPe 2.08