Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6xqpg2: 6xqp G:113-201 [393440] Other proteins in same PDB: d6xqpa1, d6xqpb1, d6xqpb2, d6xqpc1, d6xqpc2, d6xqpd1, d6xqpd2, d6xqpe1, d6xqpf1, d6xqpf2, d6xqpg1, d6xqph1, d6xqph2 automated match to d2pyfa2 complexed with 2lj, br, cl, gol, na |
PDB Entry: 6xqp (more details), 2.9 Å
SCOPe Domain Sequences for d6xqpg2:
Sequence, based on SEQRES records: (download)
>d6xqpg2 b.1.1.2 (G:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d6xqpg2 b.1.1.2 (G:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw snksdfacanafnnsiipedtffps
Timeline for d6xqpg2: