SCOPe 2.07: Domain d6xqpe2: 6xqp E:113-201

Lineage for d6xqpe2 (6xqp E:113-201)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6xqpe2: 6xqp E:113-201 [393410]
   Other proteins in same PDB: d6xqpa1, d6xqpb1, d6xqpb2, d6xqpc1, d6xqpc2, d6xqpd1, d6xqpd2, d6xqpe1, d6xqpf1, d6xqpf2, d6xqpg1, d6xqph1, d6xqph2
   automated match to d2pyfa2
   complexed with 2lj, br, cl, gol, na

Details for d6xqpe2

PDB Entry: 6xqp, 2.9 Å

PDB Description: structure of human d462-e4 tcr in complex with human mr1-5-op-ru

PDB Compounds: (E:) TRAV12-2 alpha chain

SCOPe Domain Sequences for d6xqpe2:

Sequence, based on SEQRES records:

>d6xqpe2 b.1.1.2 (E:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6xqpe2 b.1.1.2 (E:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffps

Timeline for d6xqpe2:

• d6xqpe2 is new in SCOPe 2.07-stable
  
• d6xqpe2 appears in the current release, SCOPe 2.08