Lineage for d6xqpg1 (6xqp G:4-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368100Domain d6xqpg1: 6xqp G:4-112 [393439]
    Other proteins in same PDB: d6xqpa1, d6xqpb1, d6xqpb2, d6xqpc1, d6xqpd1, d6xqpd2, d6xqpe2, d6xqpg2
    automated match to d2pyfa1
    complexed with 2lj, br, cl, gol, na

Details for d6xqpg1

PDB Entry: 6xqp (more details), 2.9 Å

PDB Description: structure of human d462-e4 tcr in complex with human mr1-5-op-ru
PDB Compounds: (G:) TRAV12-2 alpha chain

SCOPe Domain Sequences for d6xqpg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xqpg1 b.1.1.0 (G:4-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgrft
aqlnkasqyvsllirdsqpsdsatylcavrdagnmltfgggtrlmvkpn

SCOPe Domain Coordinates for d6xqpg1:

Click to download the PDB-style file with coordinates for d6xqpg1.
(The format of our PDB-style files is described here.)

Timeline for d6xqpg1: