SCOP 1.59: Domain d1g1xf_: 1g1x F:

Lineage for d1g1xf_ (1g1x F:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)

8. Domain d1g1xf_: 1g1x F: [39328]
   Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_

Details for d1g1xf_

PDB Entry: 1g1x, 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xf_:

Sequence; same for both SEQRES and ATOM records:

>d1g1xf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

Timeline for d1g1xf_:

• d1g1xf_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1xf_ appears in SCOP 1.57
  
• d1g1xf_ appears in SCOP 1.61
  
• d1g1xf_ appears in the current release, SCOPe 2.08