Lineage for d1g1xf_ (1g1x F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80538Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 80539Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 80540Protein Ribosomal protein S6 [54997] (1 species)
  7. 80541Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)
  8. 80560Domain d1g1xf_: 1g1x F: [39328]
    Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_

Details for d1g1xf_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1xf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

SCOP Domain Coordinates for d1g1xf_:

Click to download the PDB-style file with coordinates for d1g1xf_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xf_: