SCOP 1.59: Domain d1g1xh_: 1g1x H:

Lineage for d1g1xh_ (1g1x H:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries)

8. Domain d1g1xh_: 1g1x H: [16250]
   Other proteins in same PDB: d1g1xa_, d1g1xb_, d1g1xf_, d1g1xg_

Details for d1g1xh_

PDB Entry: 1g1x, 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xh_:

Sequence, based on SEQRES records:

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft

Sequence, based on observed residues (ATOM records):

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflskilprtglsgkeqrilaktikrarilgllpft

Timeline for d1g1xh_:

• d1g1xh_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1xh_ appears in SCOP 1.57
  
• d1g1xh_ appears in SCOP 1.61
  
• d1g1xh_ appears in the current release, SCOPe 2.08