Lineage for d1g1xh_ (1g1x H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1724Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1725Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1726Protein Ribosomal protein S18 [46913] (1 species)
  7. 1727Species Thermus thermophilus [TaxId:274] [46914] (7 PDB entries)
  8. 1729Domain d1g1xh_: 1g1x H: [16250]
    Other proteins in same PDB: d1g1xa_, d1g1xb_, d1g1xf_, d1g1xg_

Details for d1g1xh_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xh_:

Sequence, based on SEQRES records: (download)

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft

Sequence, based on observed residues (ATOM records): (download)

>d1g1xh_ a.4.8.1 (H:) Ribosomal protein S18 {Thermus thermophilus}
dlrdyrnvevlkrflskilprtglsgkeqrilaktikrarilgllpft

SCOP Domain Coordinates for d1g1xh_:

Click to download the PDB-style file with coordinates for d1g1xh_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xh_: