Lineage for d6x9nh1 (6x9n H:16-103)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850409Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2850410Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2850433Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2850434Protein automated matches [254548] (7 species)
    not a true protein
  7. 2850454Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries)
  8. 2850470Domain d6x9nh1: 6x9n H:16-103 [393232]
    Other proteins in same PDB: d6x9na2, d6x9na3, d6x9nb2, d6x9nb3, d6x9nc2, d6x9nc3, d6x9nd2, d6x9nd3, d6x9ne2, d6x9ne3, d6x9nf2, d6x9nf3, d6x9ng2, d6x9ng3, d6x9nh2, d6x9nh3
    automated match to d4hv4a1
    complexed with cl, dms, edo, uyd, val

Details for d6x9nh1

PDB Entry: 6x9n (more details), 2.25 Å

PDB Description: pseudomonas aeruginosa murc with az5595
PDB Compounds: (H:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6x9nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x9nh1 c.5.1.0 (H:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga
dvlvvssainranpevasalerripvvp

SCOPe Domain Coordinates for d6x9nh1:

Click to download the PDB-style file with coordinates for d6x9nh1.
(The format of our PDB-style files is described here.)

Timeline for d6x9nh1: