Lineage for d6x9nh2 (6x9n H:104-319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904995Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2905053Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 2905054Protein automated matches [254749] (4 species)
    not a true protein
  7. 2905060Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries)
  8. 2905078Domain d6x9nh2: 6x9n H:104-319 [393233]
    Other proteins in same PDB: d6x9na1, d6x9na3, d6x9nb1, d6x9nb3, d6x9nc1, d6x9nc3, d6x9nd1, d6x9nd3, d6x9ne1, d6x9ne3, d6x9nf1, d6x9nf3, d6x9ng1, d6x9ng3, d6x9nh1, d6x9nh3
    automated match to d4hv4a2
    complexed with cl, dms, edo, uyd, val

Details for d6x9nh2

PDB Entry: 6x9n (more details), 2.25 Å

PDB Description: pseudomonas aeruginosa murc with az5595
PDB Compounds: (H:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6x9nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x9nh2 c.72.2.0 (H:104-319) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfqg

SCOPe Domain Coordinates for d6x9nh2:

Click to download the PDB-style file with coordinates for d6x9nh2.
(The format of our PDB-style files is described here.)

Timeline for d6x9nh2: