SCOPe 2.08: Domain d6x9nd1: 6x9n D:16-103

Lineage for d6x9nd1 (6x9n D:16-103)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families)

5. Family c.5.1.0: automated matches [254240] (1 protein)
   not a true family

6. Protein automated matches [254548] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries)

8. Domain d6x9nd1: 6x9n D:16-103 [393216]
   Other proteins in same PDB: d6x9na2, d6x9na3, d6x9nb2, d6x9nb3, d6x9nc2, d6x9nc3, d6x9nd2, d6x9nd3, d6x9ne2, d6x9ne3, d6x9nf2, d6x9nf3, d6x9ng2, d6x9ng3, d6x9nh2, d6x9nh3
   automated match to d4hv4a1
   complexed with cl, dms, edo, uyd, val

Details for d6x9nd1

PDB Entry: 6x9n, 2.25 Å

PDB Description: pseudomonas aeruginosa murc with az5595

PDB Compounds: (D:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6x9nd1:

Sequence; same for both SEQRES and ATOM records:

>d6x9nd1 c.5.1.0 (D:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga
dvlvvssainranpevasalerripvvp

Timeline for d6x9nd1:

• d6x9nd1 first appeared in SCOPe 2.07