Lineage for d1efga4 (1efg A:600-689)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32844Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) (S)
  5. 32845Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)
  6. 32846Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)
  7. 32847Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 32853Domain d1efga4: 1efg A:600-689 [39305]
    Other proteins in same PDB: d1efga1, d1efga2, d1efga3

Details for d1efga4

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution

SCOP Domain Sequences for d1efga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga4 d.58.11.1 (A:600-689) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqeklik

SCOP Domain Coordinates for d1efga4:

Click to download the PDB-style file with coordinates for d1efga4.
(The format of our PDB-style files is described here.)

Timeline for d1efga4: