Lineage for d1fnma5 (1fnm A:600-688)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32844Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) (S)
  5. 32845Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein)
  6. 32846Protein Elongation factor G (EF-G), domains III and V [54982] (1 species)
  7. 32847Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries)
  8. 32851Domain d1fnma5: 1fnm A:600-688 [39303]
    Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3

Details for d1fnma5

PDB Entry: 1fnm (more details), 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnma5 d.58.11.1 (A:600-688) Elongation factor G (EF-G), domains III and V {Thermus thermophilus}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqekli

SCOP Domain Coordinates for d1fnma5:

Click to download the PDB-style file with coordinates for d1fnma5.
(The format of our PDB-style files is described here.)

Timeline for d1fnma5: