Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.11: Elongation factor G (EF-G), domains III and V [54980] (1 family) |
Family d.58.11.1: Elongation factor G (EF-G), domains III and V [54981] (1 protein) |
Protein Elongation factor G (EF-G), domains III and V [54982] (1 species) |
Species Thermus thermophilus [TaxId:274] [54983] (5 PDB entries) |
Domain d1fnma5: 1fnm A:600-688 [39303] Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3 |
PDB Entry: 1fnm (more details), 2.8 Å
SCOP Domain Sequences for d1fnma5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnma5 d.58.11.1 (A:600-688) Elongation factor G (EF-G), domains III and V {Thermus thermophilus} vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl rsktqgrgsfvmffdhyqevpkqvqekli
Timeline for d1fnma5:
View in 3D Domains from same chain: (mouse over for more information) d1fnma1, d1fnma2, d1fnma3, d1fnma4 |