Lineage for d6vk6b_ (6vk6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703703Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries)
  8. 2703705Domain d6vk6b_: 6vk6 B: [392758]
    Other proteins in same PDB: d6vk6c_
    automated match to d1mtyb_
    complexed with cl, edo, fe

Details for d6vk6b_

PDB Entry: 6vk6 (more details), 1.52 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase
PDB Compounds: (B:) Methane monooxygenase

SCOPe Domain Sequences for d6vk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vk6b_ a.25.1.2 (B:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
vtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnpdwiag
gldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrfla
ayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaald
kvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneil
waghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclan
dsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqrvfgdw
kidyadkigfrvdvdqkvdavlagykn

SCOPe Domain Coordinates for d6vk6b_:

Click to download the PDB-style file with coordinates for d6vk6b_.
(The format of our PDB-style files is described here.)

Timeline for d6vk6b_: