Lineage for d6v7ya1 (6v7y A:1-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937558Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2937561Domain d6v7ya1: 6v7y A:1-180 [392581]
    Other proteins in same PDB: d6v7ya2, d6v7yb1, d6v7yb2, d6v7yf_
    automated match to d1zt4c2
    complexed with agh, cl, nag, so4

Details for d6v7ya1

PDB Entry: 6v7y (more details), 2.4 Å

PDB Description: human cd1d presenting alpha-galactosylceramide in complex with vhh nanobody 1d5
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d6v7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v7ya1 d.19.1.1 (A:1-180) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
mqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqw
etlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdi
lsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d6v7ya1:

Click to download the PDB-style file with coordinates for d6v7ya1.
(The format of our PDB-style files is described here.)

Timeline for d6v7ya1: