SCOPe 2.08: Domain d6v7ya1: 6v7y A:1-180

Lineage for d6v7ya1 (6v7y A:1-180)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)

8. Domain d6v7ya1: 6v7y A:1-180 [392581]
   Other proteins in same PDB: d6v7ya2, d6v7yb1, d6v7yb2, d6v7yf_
   automated match to d1zt4c2
   complexed with agh, cl, nag, so4

Details for d6v7ya1

PDB Entry: 6v7y, 2.4 Å

PDB Description: human cd1d presenting alpha-galactosylceramide in complex with vhh nanobody 1d5

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d6v7ya1:

Sequence; same for both SEQRES and ATOM records:

>d6v7ya1 d.19.1.1 (A:1-180) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
mqrlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqw
etlqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdi
lsfqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d6v7ya1:

• d6v7ya1 first appeared in SCOPe 2.07