![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [189241] (35 PDB entries) |
![]() | Domain d6v7yf_: 6v7y F: [392620] Other proteins in same PDB: d6v7ya1, d6v7yb1, d6v7yb2 automated match to d4nc2b_ complexed with agh, cl, nag, so4 |
PDB Entry: 6v7y (more details), 2.4 Å
SCOPe Domain Sequences for d6v7yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v7yf_ b.1.1.0 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqaggslrlscaasgssfssytmgwfrqapgkereivagirwsdespiya dsvkgrftisrdnakntlylqmnslkpedtavyycaarlvppgipiprtsesmrywgkgt lvtvss
Timeline for d6v7yf_:
![]() Domains from other chains: (mouse over for more information) d6v7ya1, d6v7ya2, d6v7yb1, d6v7yb2 |