SCOPe 2.08: Domain d6us1a_: 6us1 A:

Lineage for d6us1a_ (6us1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (24 PDB entries)

8. Domain d6us1a_: 6us1 A: [392489]
   automated match to d1ci4a_
   complexed with eoh

Details for d6us1a_

PDB Entry: 6us1, 1.65 Å

PDB Description: barrier-to-autointegration factor soaked in isobutanol: 1 of 14 in mscs set

PDB Compounds: (A:) barrier-to-autointegration factor

SCOPe Domain Sequences for d6us1a_:

Sequence; same for both SEQRES and ATOM records:

>d6us1a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d6us1a_:

• d6us1a_ first appeared in SCOPe 2.07