Lineage for d1by9__ (1by9 -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504721Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 504722Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 504729Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 504737Species Human papillomavirus type 16 [TaxId:333760] [54962] (1 PDB entry)
  8. 504738Domain d1by9__: 1by9 - [39223]

Details for d1by9__

PDB Entry: 1by9 (more details), 2.2 Å

PDB Description: crystal structure of the e2 dna-binding domain from human papillomavirus type-16: implications for its dna binding-site selection mechanism

SCOP Domain Sequences for d1by9__:

Sequence, based on SEQRES records: (download)

>d1by9__ d.58.8.1 (-) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfms

Sequence, based on observed residues (ATOM records): (download)

>d1by9__ d.58.8.1 (-) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
pktitvstgfms

SCOP Domain Coordinates for d1by9__:

Click to download the PDB-style file with coordinates for d1by9__.
(The format of our PDB-style files is described here.)

Timeline for d1by9__: