| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
| Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins) |
| Protein Papillomavirus-1 E2 protein [54959] (5 species) forms dimers with subunit beta-sheets making (8,12) barrel |
| Species Human papillomavirus type 16 [TaxId:333760] [54962] (1 PDB entry) |
| Domain d1by9__: 1by9 - [39223] |
PDB Entry: 1by9 (more details), 2.2 Å
SCOP Domain Sequences for d1by9__:
Sequence, based on SEQRES records: (download)
>d1by9__ d.58.8.1 (-) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfms
>d1by9__ d.58.8.1 (-) Papillomavirus-1 E2 protein {Human papillomavirus type 16}
ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
pktitvstgfms
Timeline for d1by9__: