PDB entry 1by9

View 1by9 on RCSB PDB site
Description: crystal structure of the e2 dna-binding domain from human papillomavirus type-16: implications for its dna binding-site selection mechanism
Deposited on 1998-10-27, released 1999-04-27
The last revision prior to the SCOP 1.69 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1by9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1by9_ (-)
    ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
    qflsqvkipktitvstgfmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1by9_ (-)
    ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
    pktitvstgfms