Lineage for d2up1a2 (2up1 A:99-190)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries) 
Domain d2up1a2: 2up1 A:99-190 [39152]
Details for d2up1a2
PDB Entry: 2up1 (more details), 2.1 Å
PDB Description: structure of up1-telomeric dna complex
SCOP Domain Sequences for d2up1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2up1a2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkalskqemasas
SCOP Domain Coordinates for d2up1a2:
Click to download the PDB-style file with coordinates for d2up1a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2up1a2:
- d2up1a2 first appeared (with stable ids) in SCOP 1.55
- d2up1a2 appears in SCOP 1.59
- d2up1a2 appears in SCOP 1.63
- d2up1a2 appears in the current release, SCOPe 2.08
View in 3D
