Lineage for d2up1a2 (2up1 A:99-190)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32659Protein Nuclear ribonucleoprotein A1, RNP A1, UP1 [54930] (1 species)
  7. 32660Species Human (Homo sapiens) [TaxId:9606] [54931] (3 PDB entries)
  8. 32666Domain d2up1a2: 2up1 A:99-190 [39152]

Details for d2up1a2

PDB Entry: 2up1 (more details), 2.1 Å

PDB Description: structure of up1-telomeric dna complex
PDB Compounds: (A:) protein (heterogeneous nuclear ribonucleoprotein a1)

SCOP Domain Sequences for d2up1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2up1a2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1, RNP A1, UP1 {Human (Homo sapiens)}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkalskqemasas

SCOP Domain Coordinates for d2up1a2:

Click to download the PDB-style file with coordinates for d2up1a2.
(The format of our PDB-style files is described here.)

Timeline for d2up1a2: