![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) Uniprot P09651 7-188 |
![]() | Domain d2up1a2: 2up1 A:99-190 [39152] protein/DNA complex |
PDB Entry: 2up1 (more details), 2.1 Å
SCOPe Domain Sequences for d2up1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2up1a2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds vdkiviqkyhtvnghncevrkalskqemasas
Timeline for d2up1a2: