Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (14 proteins) |
Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries) |
Domain d1up1_2: 1up1 99-182 [39150] |
PDB Entry: 1up1 (more details), 1.9 Å
SCOP Domain Sequences for d1up1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up1_2 d.58.7.1 (99-182) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)} gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds vdkiviqkyhtvnghncevrkals
Timeline for d1up1_2: