Lineage for d1up1_2 (1up1 99-182)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257462Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 257463Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries)
  8. 257469Domain d1up1_2: 1up1 99-182 [39150]

Details for d1up1_2

PDB Entry: 1up1 (more details), 1.9 Å

PDB Description: up1, the two rna-recognition motif domain of hnrnp a1

SCOP Domain Sequences for d1up1_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up1_2 d.58.7.1 (99-182) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkals

SCOP Domain Coordinates for d1up1_2:

Click to download the PDB-style file with coordinates for d1up1_2.
(The format of our PDB-style files is described here.)

Timeline for d1up1_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1up1_1