Lineage for d1up1a2 (1up1 A:99-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951989Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 2951990Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. 2951998Domain d1up1a2: 1up1 A:99-182 [39150]

Details for d1up1a2

PDB Entry: 1up1 (more details), 1.9 Å

PDB Description: up1, the two rna-recognition motif domain of hnrnp a1
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1up1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up1a2 d.58.7.1 (A:99-182) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkals

SCOPe Domain Coordinates for d1up1a2:

Click to download the PDB-style file with coordinates for d1up1a2.
(The format of our PDB-style files is described here.)

Timeline for d1up1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1up1a1