Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
Protein automated matches [194413] (5 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries) |
Domain d6r0md_: 6r0m D: [391288] Other proteins in same PDB: d6r0ma2, d6r0mc2 automated match to d5g49b_ |
PDB Entry: 6r0m (more details), 2.3 Å
SCOPe Domain Sequences for d6r0md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r0md_ a.22.1.3 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} nhslplarikkimkadedvrmisaeapvvfaracemfileltlrswnhteenkrrtlqkn diaaavtrtdifdflvdivpr
Timeline for d6r0md_: