Lineage for d6r0md_ (6r0m D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699191Protein automated matches [194413] (5 species)
    not a true protein
  7. 2699207Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries)
  8. 2699213Domain d6r0md_: 6r0m D: [391288]
    Other proteins in same PDB: d6r0ma2, d6r0mc2
    automated match to d5g49b_

Details for d6r0md_

PDB Entry: 6r0m (more details), 2.3 Å

PDB Description: histone fold domain of atnf-yb2/nf-yc3 in p212121
PDB Compounds: (D:) nf-yc3

SCOPe Domain Sequences for d6r0md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r0md_ a.22.1.3 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nhslplarikkimkadedvrmisaeapvvfaracemfileltlrswnhteenkrrtlqkn
diaaavtrtdifdflvdivpr

SCOPe Domain Coordinates for d6r0md_:

Click to download the PDB-style file with coordinates for d6r0md_.
(The format of our PDB-style files is described here.)

Timeline for d6r0md_: