Lineage for d6at1b1 (6at1 B:8-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133437Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 133438Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 133439Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 133440Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 133449Domain d6at1b1: 6at1 B:8-100 [39023]
    Other proteins in same PDB: d6at1a1, d6at1a2, d6at1b2, d6at1c1, d6at1c2, d6at1d2

Details for d6at1b1

PDB Entry: 6at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d6at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d6at1b1:

Click to download the PDB-style file with coordinates for d6at1b1.
(The format of our PDB-style files is described here.)

Timeline for d6at1b1: