Lineage for d6at1b1 (6at1 B:8-100)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. Domain d6at1b1: 6at1 B:8-100 [39023]
    Other proteins in same PDB: d6at1a1, d6at1a2, d6at1b2, d6at1c1, d6at1c2, d6at1d2
    complexed with zn

Details for d6at1b1

PDB Entry: 6at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d6at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d6at1b1 are not available.

Timeline for d6at1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6at1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6at1a1, d6at1a2, d6at1c1, d6at1c2, d6at1d1, d6at1d2