Lineage for d6at1a1 (6at1 A:1-150)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127168Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 127169Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 127170Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 127171Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 127179Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 127208Domain d6at1a1: 6at1 A:1-150 [35112]
    Other proteins in same PDB: d6at1b1, d6at1b2, d6at1d1, d6at1d2

Details for d6at1a1

PDB Entry: 6at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d6at1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at1a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

SCOP Domain Coordinates for d6at1a1:

Click to download the PDB-style file with coordinates for d6at1a1.
(The format of our PDB-style files is described here.)

Timeline for d6at1a1: