Lineage for d6jika_ (6jik A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2867986Species Aspergillus fumigatus [TaxId:41122] [390209] (1 PDB entry)
  8. 2867987Domain d6jika_: 6jik A: [390210]
    automated match to d4f38a_
    complexed with gsp, mg

Details for d6jika_

PDB Entry: 6jik (more details), 2.35 Å

PDB Description: aspergillus fumigatus rho1 gsgtp
PDB Compounds: (A:) Rho GTPase Rho1

SCOPe Domain Sequences for d6jika_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jika_ c.37.1.8 (A:) automated matches {Aspergillus fumigatus [TaxId: 41122]}
eirrklvivgdgacgktcllivnskgtfpevyvptvfenyvadvevdgkhvelalwdtag
qedydrlrplsypdshvilicfaidspdsldnvqekwisevlhfcqglpiilvgckkdlr
hdpktieelhktsqkpvtpeqgeevrkkigaykylecsartnegvrevfeaatraalltk
th

SCOPe Domain Coordinates for d6jika_:

Click to download the PDB-style file with coordinates for d6jika_.
(The format of our PDB-style files is described here.)

Timeline for d6jika_: