Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Aspergillus fumigatus [TaxId:41122] [390209] (1 PDB entry) |
Domain d6jika_: 6jik A: [390210] automated match to d4f38a_ complexed with gsp, mg |
PDB Entry: 6jik (more details), 2.35 Å
SCOPe Domain Sequences for d6jika_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jika_ c.37.1.8 (A:) automated matches {Aspergillus fumigatus [TaxId: 41122]} eirrklvivgdgacgktcllivnskgtfpevyvptvfenyvadvevdgkhvelalwdtag qedydrlrplsypdshvilicfaidspdsldnvqekwisevlhfcqglpiilvgckkdlr hdpktieelhktsqkpvtpeqgeevrkkigaykylecsartnegvrevfeaatraalltk th
Timeline for d6jika_: