Lineage for d4f38a_ (4f38 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868665Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries)
  8. 2868681Domain d4f38a_: 4f38 A: [195316]
    Other proteins in same PDB: d4f38b_
    automated match to d1cc0a_
    complexed with ger, gnp, mg

Details for d4f38a_

PDB Entry: 4f38 (more details), 2.8 Å

PDB Description: Crystal structure of geranylgeranylated RhoA in complex with RhoGDI in its active GPPNHP-bound form
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d4f38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f38a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
arrgkkksgc

SCOPe Domain Coordinates for d4f38a_:

Click to download the PDB-style file with coordinates for d4f38a_.
(The format of our PDB-style files is described here.)

Timeline for d4f38a_: