Lineage for d6wcva2 (6wcv A:131-306)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439025Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 3050827Species Homo sapiens [TaxId:9606] [350889] (2 PDB entries)
  8. 3089447Domain d6wcva2: 6wcv A:131-306 [389509]
    Other proteins in same PDB: d6wcva1, d6wcva3, d6wcvb1, d6wcvb2
    automated match to d1euda2
    complexed with tuy

Details for d6wcva2

PDB Entry: 6wcv (more details), 1.52 Å

PDB Description: tartryl-coa bound to human gtp-specific succinyl-coa synthetase
PDB Compounds: (A:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6wcva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wcva2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Homo sapiens [TaxId: 9606]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnskpvvsfiaglt
appgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d6wcva2:

Click to download the PDB-style file with coordinates for d6wcva2.
(The format of our PDB-style files is described here.)

Timeline for d6wcva2:

  • d6wcva2 is new in SCOPe 2.07-stable