SCOPe 2.08: Domain d6wcva2: 6wcv A:131-306

Lineage for d6wcva2 (6wcv A:131-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [350889] (2 PDB entries)

8. Domain d6wcva2: 6wcv A:131-306 [389509]
   Other proteins in same PDB: d6wcva1, d6wcva3, d6wcvb1, d6wcvb2
   automated match to d1euda2
   complexed with tuy

Details for d6wcva2

PDB Entry: 6wcv, 1.52 Å

PDB Description: tartryl-coa bound to human gtp-specific succinyl-coa synthetase

PDB Compounds: (A:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6wcva2:

Sequence; same for both SEQRES and ATOM records:

>d6wcva2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnskpvvsfiaglt
appgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykefekrkml

Timeline for d6wcva2:

• d6wcva2 first appeared in SCOPe 2.07