SCOPe 2.07: Domain d6wcvb2: 6wcv B:246-393

Lineage for d6wcvb2 (6wcv B:246-393)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)

7. Species Homo sapiens [TaxId:9606] [389535] (1 PDB entry)

8. Domain d6wcvb2: 6wcv B:246-393 [389536]
   Other proteins in same PDB: d6wcva1, d6wcva2, d6wcva3, d6wcvb1
   automated match to d2nu8e1
   complexed with tuy

Details for d6wcvb2

PDB Entry: 6wcv, 1.52 Å

PDB Description: tartryl-coa bound to human gtp-specific succinyl-coa synthetase

PDB Compounds: (B:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d6wcvb2:

Sequence; same for both SEQRES and ATOM records:

>d6wcvb2 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Homo sapiens [TaxId: 9606]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkeaqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvqeaq
kilnnsglpitsaidledaakkavasva

Timeline for d6wcvb2:

• d6wcvb2 is new in SCOPe 2.07-stable