Lineage for d6wcvb2 (6wcv B:246-393)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439066Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 3089473Species Homo sapiens [TaxId:9606] [389535] (1 PDB entry)
  8. 3089474Domain d6wcvb2: 6wcv B:246-393 [389536]
    Other proteins in same PDB: d6wcva1, d6wcva2, d6wcva3, d6wcvb1
    automated match to d2nu8e1
    complexed with tuy

Details for d6wcvb2

PDB Entry: 6wcv (more details), 1.52 Å

PDB Description: tartryl-coa bound to human gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d6wcvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wcvb2 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Homo sapiens [TaxId: 9606]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkeaqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvqeaq
kilnnsglpitsaidledaakkavasva

SCOPe Domain Coordinates for d6wcvb2:

Click to download the PDB-style file with coordinates for d6wcvb2.
(The format of our PDB-style files is described here.)

Timeline for d6wcvb2:

  • d6wcvb2 is new in SCOPe 2.07-stable