PDB entry 6wcv

View 6wcv on RCSB PDB site
Description: Tartryl-CoA bound to human GTP-specific succinyl-CoA synthetase
Class: ligase
Keywords: Complex, LIGASE
Deposited on 2020-03-31, released 2020-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53597 (1-305)
      • expression tag (306)
    Domains in SCOPe 2.07: d6wcva1, d6wcva2, d6wcva3
  • Chain 'B':
    Compound: Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96I99 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6wcvb1, d6wcvb2
  • Heterogens: TUY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6wcvA (A:)
    msytasrqhlyvdkntkiicqgftgkqgtfhsqqaleygtklvggttpgkggqthlglpv
    fntvkeakeqtgatasviyvpppfaaaaineaieaeiplvvcitegipqqdmvrvkhkll
    rqektrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgq
    slcvgiggdpfngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnsk
    pvvsfiagltappgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykef
    ekrkmlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wcvA (A:)
    sytasrqhlyvdkntkiicqgftgkqgtfhsqqaleygtklvggttpgkggqthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaieaeiplvvcitegipqqdmvrvkhkllr
    qektrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdfidcleiflndsategiiligeiggnaeenaaeflkqhnsgpnskp
    vvsfiagltappgrrmghagaiiaggkggakekisalqsagvvvsmspaqlgttiykefe
    krkmle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6wcvB (B:)
    mnlqeyqskklmsdngvrvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfn
    sglkggvhltkdpnvvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidifegikdsqaqrmaenlgfvgpl
    ksqaadqitklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    keaqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vqeaqkilnnsglpitsaidledaakkavasvakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wcvB (B:)
    mnlqeyqskklmsdngvrvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfn
    sglkggvhltkdpnvvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidifegikdsqaqrmaenlgfvgpl
    ksqaadqitklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    keaqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vqeaqkilnnsglpitsaidledaakkavasva